PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005941-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 1074aa    MW: 117914 Da    PI: 4.6457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005941-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.9e-194692148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEdell +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
    NNU_005941-RA 46 KGQWTPEEDELLRRAVQRYKGRNWKKIAECFK-DRTDVQCLHRWQKVL 92
                     799****************************9.************986 PP

2Myb_DNA-binding569.1e-1898144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
    NNU_005941-RA  98 KGPWSKEEDDIIVELVNKFGAKKWSIIAQALP-GRIGKQCRERWHNHL 144
                      79******************************.*************97 PP

3Myb_DNA-binding49.51e-15150192145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
    NNU_005941-RA 150 KDAWTQEEELTLIQAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 192
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.914192IPR017930Myb domain
SuperFamilySSF466893.45E-164298IPR009057Homeodomain-like
SMARTSM007174.3E-164594IPR001005SANT/Myb domain
PfamPF002497.0E-174692IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2348108IPR009057Homeodomain-like
CDDcd001677.63E-154992No hitNo description
PROSITE profilePS5129431.04493148IPR017930Myb domain
SuperFamilySSF466892.47E-3195191IPR009057Homeodomain-like
SMARTSM007173.1E-1797146IPR001005SANT/Myb domain
PfamPF002491.3E-1698144IPR001005SANT/Myb domain
CDDcd001678.24E-15100144No hitNo description
Gene3DG3DSA:1.10.10.609.6E-27109152IPR009057Homeodomain-like
SMARTSM007179.0E-15149197IPR001005SANT/Myb domain
PROSITE profilePS5129419.383149199IPR017930Myb domain
PfamPF002497.6E-14150193IPR001005SANT/Myb domain
CDDcd001672.56E-11152192No hitNo description
Gene3DG3DSA:1.10.10.604.1E-21153199IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1074 aa     Download sequence    Send to blast
MASDSTKGVR RVEVPVNAPP DGGSDSFQKI RPMHGRTSGP TRRSTKGQWT PEEDELLRRA  60
VQRYKGRNWK KIAECFKDRT DVQCLHRWQK VLNPELVKGP WSKEEDDIIV ELVNKFGAKK  120
WSIIAQALPG RIGKQCRERW HNHLNPAINK DAWTQEEELT LIQAHQIYGN KWAELTKFLP  180
GRTDNAIKNH WNSSVKKKLD SYLASGLLAQ FQGLPHVRNP TTRCMPSSSI TVQHSSGDNN  240
VLKDGAEAGE LSECSQGSAA IGCSQSGSDM VNTVPVHVQE KLKSSEEANQ REGQSSNSSC  300
TGQYYASLRE APEILNSVVV SVKSPEGNVL QEDDETTGNN GFKFESDELP VSLVEVIQEP  360
SELFETSGHC TSGVDENNSM EFNSSISMEN IIVDNDKQNL SITEGDFGGV SFSEAGMHGC  420
FSLENPINQN IIDLDGCTDS FLCHSDIQTS ETVGNLVSHS YYPLGSSPML GTTCCQTLLS  480
GPSLHCPADN ELVYGGECDE VRDMLRGTQD SELVTNSCPC FICPDESTRF PYDGDLDKVC  540
QPVETDQAKE ASESLAVDIF GSLASDTIGN LPCMDENTIM VTEHQDSESL FYEPPRFPSL  600
DIPFVSCDLI PSGSDTHQAY SPLGIRQLMM SSMNCSTPYS FWDSPTHDDS PDGVLKSAAK  660
SFLCTPSILK KRQRDLLSPL QERKSDKKLE RDASQGLFCT TLRDLSCLDV MFDDCGGCKT  720
SSLSSIEGTI LSPSCCKKKG SIASNEDKEN LNPAFEVQKD GPALPDNRIS EAEFDNGSCQ  780
DKIKEVNPDM VKADANEKIQ TQPSGVFVEQ NVSDLVFFSP DRDAFPRKRA LSAVQTPRNQ  840
YSRNSEAMLN QTGSSKSSSR SRCISLLISP AVCEKRHGNN SVPDASLQSG SSPNPVEVTF  900
ESADGADIES FIMFGDTPAM KRGIESPSSW KSPWFMNSFL PGPRIDTDIT IEDIGFLLSP  960
GDRSYDAIGL MRQLSEHTAA ALAEAQEVLA SENTEIYLKE ERQSDQNLAQ ESFVDNEKEI  1020
HVSLSPGVLT ERRALDFSGC MTPQKGTENR KHKGAASAAV SFSSPSSYLM KGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-68461996159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-68461996159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254092.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLV4WBV50.0V4WBV5_9R
STRINGVIT_11s0016g03750.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein